PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 290aa    MW: 32750.7 Da    PI: 7.8731
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-24531PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.71e-18139193256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Lsa010638 139 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 193
                788899***********************************************98 PP

2HD-ZIP_I/II1284e-41139228191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
    Lsa010638 139 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKELQELR-AL 228
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.2E-311113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.7E-18125189IPR009057Homeodomain-like
SuperFamilySSF466898.36E-19125196IPR009057Homeodomain-like
PROSITE profilePS5007117.394135195IPR001356Homeobox domain
SMARTSM003893.3E-16137199IPR001356Homeobox domain
PfamPF000463.7E-16139193IPR001356Homeobox domain
CDDcd000862.63E-15139196No hitNo description
PRINTSPR000312.9E-5166175IPR000047Helix-turn-helix motif
PROSITE patternPS000270170193IPR017970Homeobox, conserved site
PRINTSPR000312.9E-5175191IPR000047Helix-turn-helix motif
PfamPF021831.0E-10195229IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.4E-26195238IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MVEKEDLGLS LSLNFPATME GNPSSLQLNL MPSFVSSSSS FNHLHRTPNW SDSCPSSSDR  60
NIADAFKVET RSFLKGIDVN RIPPTAAEVE EEAGVSSPNS TISSISGKRS ERDLPVNEQD  120
GERASSRGMS DDEDGDNSRK KLRLSKDQSA ILEESFKEHN TLNPKQKLAL AKRLGLRPRQ  180
VEVWFQNRRA RTKLKQTEVD CEFLKRCCEN LTEENRRLQK ELQELRALKL SPQFYMQMAP  240
PTTLTMCPSC ERVAAPPSSA VEKPADHQHN RNHLTGLNQN HHRSLPFNPW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137143SRKKLRL
2187195RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007039762.11e-135Homeobox-leucine zipper protein 4 / HD-ZIP protein
SwissprotQ054661e-108HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A103XJS21e-179A0A103XJS2_CYNCS; HD-ZIP protein, N-terminal
STRINGPOPTR_0003s07760.11e-132(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-104homeobox protein 2